Lineage for d1rfna_ (1rfn A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein Coagulation factor IXa, protease domain [50583] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries) 
Domain d1rfna_: 1rfn A: [26354]
Other proteins in same PDB: d1rfnb_
complexed with ca, pbz, tbu
Details for d1rfna_
PDB Entry: 1rfn (more details), 2.8 Å
PDB Description: human coagulation factor ixa in complex with p-amino benzamidine
PDB Compounds: (A:) protein (coagulation factor ix)SCOPe Domain Sequences for d1rfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
SCOPe Domain Coordinates for d1rfna_:
Click to download the PDB-style file with coordinates for d1rfna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rfna_:
- d1rfna_ first appeared (with stable ids) in SCOP 1.55
- d1rfna_ appears in SCOPe 2.05
- d1rfna_ appears in SCOPe 2.07
- d1rfna_ appears in the current release, SCOPe 2.08
View in 3D
