Lineage for d2wkxa1 (2wkx A:180-261)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.20: PGBD-like [47089] (1 superfamily)
core: 3 helices; bundle, closed, left-handed twist; parallelSuperfamily a.20.1: PGBD-like [47090] (2 families) 
Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins) Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species) Species Escherichia coli [TaxId:562] [140391] (2 PDB entries)
Uniprot P75820 195-275
Domain d2wkxa1: 2wkx A:180-261 [169423]
Other proteins in same PDB: d2wkxa2
complexed with cl, gol, zn
Details for d2wkxa1
PDB Entry: 2wkx (more details), 1.8 Å
PDB Description: crystal structure of the native e. coli zinc amidase amid
PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase amidSCOPe Domain Sequences for d2wkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkxa1 a.20.1.1 (A:180-261) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]}
pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly
ngeadaetqaiaeallekygqd
SCOPe Domain Coordinates for d2wkxa1:
Click to download the PDB-style file with coordinates for d2wkxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wkxa1:
- d2wkxa1 first appeared in SCOPe 2.01
- d2wkxa1 appears in SCOPe 2.04
- d2wkxa1 appears in SCOPe 2.06
- d2wkxa1 appears in the current release, SCOPe 2.08
View in 3D
