Class a: All alpha proteins [46456] (290 folds) |
Fold a.20: PGBD-like [47089] (1 superfamily) core: 3 helices; bundle, closed, left-handed twist; parallel |
Superfamily a.20.1: PGBD-like [47090] (3 families) |
Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins) |
Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species) |
Species Escherichia coli [TaxId:562] [140391] (3 PDB entries) Uniprot P75820 195-275 |
Domain d2wkxa1: 2wkx A:180-261 [169423] Other proteins in same PDB: d2wkxa2 complexed with cl, gol, zn |
PDB Entry: 2wkx (more details), 1.8 Å
SCOPe Domain Sequences for d2wkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkxa1 a.20.1.1 (A:180-261) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly ngeadaetqaiaeallekygqd
Timeline for d2wkxa1: