Lineage for d2vj8a1 (2vj8 A:461-610)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500776Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 1500777Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 1500778Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries)
    Uniprot P09960
  8. 1500792Domain d2vj8a1: 2vj8 A:461-610 [153183]
    Other proteins in same PDB: d2vj8a2, d2vj8a3
    automated match to d1hs6a1
    complexed with act, ha2, imd, yb, zn

Details for d2vj8a1

PDB Entry: 2vj8 (more details), 1.8 Å

PDB Description: complex of human leukotriene a4 hydrolase with a hydroxamic acid inhibitor
PDB Compounds: (A:) lta4h protein

SCOPe Domain Sequences for d2vj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vj8a1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d2vj8a1:

Click to download the PDB-style file with coordinates for d2vj8a1.
(The format of our PDB-style files is described here.)

Timeline for d2vj8a1: