Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63610] (58 PDB entries) Uniprot P09960 |
Domain d2vj8a1: 2vj8 A:461-610 [153183] Other proteins in same PDB: d2vj8a2, d2vj8a3 automated match to d1hs6a1 complexed with act, ha2, imd, yb, zn |
PDB Entry: 2vj8 (more details), 1.8 Å
SCOPe Domain Sequences for d2vj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vj8a1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d2vj8a1: