| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
| Protein automated matches [226968] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries) |
| Domain d2vj3a1: 2vj3 A:411-452 [153180] Other proteins in same PDB: d2vj3a4 automated match to d2vj3a1 complexed with ca, cl, na |
PDB Entry: 2vj3 (more details), 2.6 Å
SCOPe Domain Sequences for d2vj3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vj3a1 g.3.11.0 (A:411-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdvdecslganpcehagkcintlgsfecqclqgytgprceid
Timeline for d2vj3a1: