Class g: Small proteins [56992] (92 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.0: automated matches [196454] (1 protein) not a true family |
Protein automated matches [196455] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255137] (5 PDB entries) |
Domain d2rsja_: 2rsj A: [243768] automated match to d2wbua_ complexed with zn |
PDB Entry: 2rsj (more details)
SCOPe Domain Sequences for d2rsja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rsja_ g.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgkiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkh tgekfacdycsftclskghlkvhiervhkkik
Timeline for d2rsja_: