Lineage for d2rsja_ (2rsj A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704720Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1704721Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1705086Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 1705087Protein automated matches [196455] (4 species)
    not a true protein
  7. 1705092Species Human (Homo sapiens) [TaxId:9606] [255137] (2 PDB entries)
  8. 1705093Domain d2rsja_: 2rsj A: [243768]
    automated match to d2wbua_
    complexed with zn

Details for d2rsja_

PDB Entry: 2rsj (more details)

PDB Description: Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT
PDB Compounds: (A:) Zinc finger protein ZFAT

SCOPe Domain Sequences for d2rsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rsja_ g.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkh
tgekfacdycsftclskghlkvhiervhkkik

SCOPe Domain Coordinates for d2rsja_:

Click to download the PDB-style file with coordinates for d2rsja_.
(The format of our PDB-style files is described here.)

Timeline for d2rsja_: