![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.0: automated matches [196454] (1 protein) not a true family |
![]() | Protein automated matches [196455] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [196456] (2 PDB entries) |
![]() | Domain d2wbua_: 2wbu A: [196458] automated match to d2ee8a1 protein/DNA complex; complexed with zn |
PDB Entry: 2wbu (more details), 2.5 Å
SCOPe Domain Sequences for d2wbua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbua_ g.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} thtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrkhtghr pfqcqkcdrafsrsdhlalhmkrhf
Timeline for d2wbua_: