PDB entry 2rsj

View 2rsj on RCSB PDB site
Description: Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT
Class: metal binding protein
Keywords: zfat, metal binding protein
Deposited on 2012-03-07, released 2013-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein ZFAT
    Species: Homo sapiens [TaxId:9606]
    Gene: ZFAT, KIAA1485, ZFAT1, ZNF406
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P243 (7-91)
      • expression tag (0-6)
    Domains in SCOPe 2.05: d2rsja_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rsjA (A:)
    gssgssgkiftceycnkvfkfkhslqahlrihtnekpykcpqcsyasaikanlnvhlrkh
    tgekfacdycsftclskghlkvhiervhkkik