Class b: All beta proteins [48724] (176 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) Pfam PF11648 |
Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins) |
Protein LGP2 C-terminal domain [254413] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254852] (1 PDB entry) |
Domain d2rqaa_: 2rqa A: [243748] complexed with zn |
PDB Entry: 2rqa (more details)
SCOPe Domain Sequences for d2rqaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rqaa_ b.88.2.1 (A:) LGP2 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gphmqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvf kdwkpggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpd fdflqhcaenlsdlsld
Timeline for d2rqaa_: