Lineage for d2rqaa1 (2rqa A:546-678)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407553Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2407630Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2407631Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 protein domains)
  6. 2407632Protein LGP2 C-terminal domain [254413] (1 species)
  7. 2407633Species Human (Homo sapiens) [TaxId:9606] [254852] (1 PDB entry)
  8. 2407634Domain d2rqaa1: 2rqa A:546-678 [243748]
    Other proteins in same PDB: d2rqaa2
    complexed with zn

Details for d2rqaa1

PDB Entry: 2rqa (more details)

PDB Description: Solution structure of LGP2 CTD
PDB Compounds: (A:) ATP-dependent RNA helicase DHX58

SCOPe Domain Sequences for d2rqaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rqaa1 b.88.2.1 (A:546-678) LGP2 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvfkdwk
pggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdfdfl
qhcaenlsdlsld

SCOPe Domain Coordinates for d2rqaa1:

Click to download the PDB-style file with coordinates for d2rqaa1.
(The format of our PDB-style files is described here.)

Timeline for d2rqaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rqaa2