Lineage for d2rqaa_ (2rqa A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810140Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 1810210Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 1810211Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)
  6. 1810212Protein LGP2 C-terminal domain [254413] (1 species)
  7. 1810213Species Human (Homo sapiens) [TaxId:9606] [254852] (1 PDB entry)
  8. 1810214Domain d2rqaa_: 2rqa A: [243748]
    complexed with zn

Details for d2rqaa_

PDB Entry: 2rqa (more details)

PDB Description: solution structure of lgp2 ctd
PDB Compounds: (A:) ATP-dependent RNA helicase DHX58

SCOPe Domain Sequences for d2rqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rqaa_ b.88.2.1 (A:) LGP2 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gphmqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvf
kdwkpggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpd
fdflqhcaenlsdlsld

SCOPe Domain Coordinates for d2rqaa_:

Click to download the PDB-style file with coordinates for d2rqaa_.
(The format of our PDB-style files is described here.)

Timeline for d2rqaa_: