Lineage for d2qwnb_ (2qwn B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1718905Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1718906Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 1718907Protein Auxilin J-domain [88969] (1 species)
  7. 1718908Species Cow (Bos taurus) [TaxId:9913] [88970] (7 PDB entries)
  8. 1718913Domain d2qwnb_: 2qwn B: [151429]
    Other proteins in same PDB: d2qwna1, d2qwna2
    automated match to d2qwnb_
    complexed with adp, mg, na, po4

Details for d2qwnb_

PDB Entry: 2qwn (more details), 2.4 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state
PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwnb_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}
mdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavl
vvhpckatgqpyeqyakmifmelndawsefenqg

SCOPe Domain Coordinates for d2qwnb_:

Click to download the PDB-style file with coordinates for d2qwnb_.
(The format of our PDB-style files is described here.)

Timeline for d2qwnb_: