Lineage for d2qn6a2 (2qn6 A:321-415)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) 
probably related to the second domain and its superfamiy by a circular permutation
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) Protein Initiation factor eIF2 gamma subunit [74964] (3 species) 
Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
Uniprot Q980A5 321-415
Domain d2qn6a2: 2qn6 A:321-415 [150912]
Other proteins in same PDB: d2qn6a1, d2qn6a3, d2qn6b_
automated match to d2ahoa2
complexed with gdp, mg
Details for d2qn6a2
PDB Entry: 2qn6 (more details), 2.15 Å
PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (A:) Translation initiation factor 2 gamma subunitSCOPe Domain Sequences for d2qn6a2:
Sequence, based on SEQRES records: (download)
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei
Sequence, based on observed residues (ATOM records): (download)
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvvdpiraketlmlsvgssttlgivtsvkkdeievelrrpva
vwsnnirtvisrqiagrwrmigwglvei
SCOPe Domain Coordinates for d2qn6a2:
Click to download the PDB-style file with coordinates for d2qn6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qn6a2:
- d2qn6a2 first appeared in SCOP 1.75
- d2qn6a2 appears in SCOPe 2.07
View in 3D
