Lineage for d2qn6a2 (2qn6 A:321-415)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403439Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2403514Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 2403523Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
    Uniprot Q980A5 321-415
  8. 2403525Domain d2qn6a2: 2qn6 A:321-415 [150912]
    Other proteins in same PDB: d2qn6a1, d2qn6a3, d2qn6b_
    automated match to d2ahoa2
    complexed with gdp, mg

Details for d2qn6a2

PDB Entry: 2qn6 (more details), 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2qn6a2:

Sequence, based on SEQRES records: (download)

>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Sequence, based on observed residues (ATOM records): (download)

>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvvdpiraketlmlsvgssttlgivtsvkkdeievelrrpva
vwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d2qn6a2:

Click to download the PDB-style file with coordinates for d2qn6a2.
(The format of our PDB-style files is described here.)

Timeline for d2qn6a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qn6b_