Lineage for d2p5ra_ (2p5r A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134888Species Populus trichocarpa [TaxId:3695] [187360] (4 PDB entries)
  8. 2134896Domain d2p5ra_: 2p5r A: [167020]
    automated match to d2f8aa1
    complexed with ca

Details for d2p5ra_

PDB Entry: 2p5r (more details), 2.45 Å

PDB Description: crystal structure of the poplar glutathione peroxidase 5 in the oxidized form
PDB Compounds: (A:) Glutathione peroxidase 5

SCOPe Domain Sequences for d2p5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5ra_ c.47.1.0 (A:) automated matches {Populus trichocarpa [TaxId: 3695]}
sknpesvhdftvkdakendvdlsifkgkvllivnvaskcgmtnsnyaemnqlyekykdqg
leilafpcnqfgeeepgtndqitdfvctrfksefpifdkidvngenasplyrflklgkwg
ifgddiqwnfakflvnkdgqvvdryypttsplslerdikqllei

SCOPe Domain Coordinates for d2p5ra_:

Click to download the PDB-style file with coordinates for d2p5ra_.
(The format of our PDB-style files is described here.)

Timeline for d2p5ra_: