Lineage for d2p5ra_ (2p5r A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (165 species)
not a true protein
Species Populus trichocarpa [TaxId:3695] [187360] (4 PDB entries) 
Domain d2p5ra_: 2p5r A: [167020]
automated match to d2f8aa1
complexed with ca
Details for d2p5ra_
PDB Entry: 2p5r (more details), 2.45 Å
PDB Description: crystal structure of the poplar glutathione peroxidase 5 in the oxidized form
PDB Compounds: (A:) Glutathione peroxidase 5SCOPe Domain Sequences for d2p5ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5ra_ c.47.1.0 (A:) automated matches {Populus trichocarpa [TaxId: 3695]}
sknpesvhdftvkdakendvdlsifkgkvllivnvaskcgmtnsnyaemnqlyekykdqg
leilafpcnqfgeeepgtndqitdfvctrfksefpifdkidvngenasplyrflklgkwg
ifgddiqwnfakflvnkdgqvvdryypttsplslerdikqllei
SCOPe Domain Coordinates for d2p5ra_:
Click to download the PDB-style file with coordinates for d2p5ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p5ra_:
- d2p5ra_ first appeared in SCOPe 2.01
- d2p5ra_ appears in SCOPe 2.05
- d2p5ra_ appears in SCOPe 2.07
- d2p5ra_ appears in the current release, SCOPe 2.08
View in 3D
