Lineage for d2f8aa1 (2f8a A:12-195)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132842Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2133004Protein Glutathione peroxidase [52902] (2 species)
    contains many insertions in the common fold
  7. 2133008Species Human (Homo sapiens) [TaxId:9606] [142365] (1 PDB entry)
    Uniprot P07203 12-195
  8. 2133009Domain d2f8aa1: 2f8a A:12-195 [133119]
    Other proteins in same PDB: d2f8aa2
    complexed with mla; mutant

Details for d2f8aa1

PDB Entry: 2f8a (more details), 1.5 Å

PDB Description: crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 1
PDB Compounds: (A:) Glutathione peroxidase 1

SCOPe Domain Sequences for d2f8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]}
qsvyafsarplaggepvslgslrgkvllienvaslggttvrdytqmnelqrrlgprglvv
lgfpcnqfghqenakneeilnslkyvrpgggfepnfmlfekcevngagahplfaflreal
papsddatalmtdpklitwspvcrndvawnfekflvgpdgvplrrysrrfqtidiepdie
alls

SCOPe Domain Coordinates for d2f8aa1:

Click to download the PDB-style file with coordinates for d2f8aa1.
(The format of our PDB-style files is described here.)

Timeline for d2f8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8aa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2f8ab_