Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Glutathione peroxidase [52902] (2 species) contains many insertions in the common fold |
Species Human (Homo sapiens) [TaxId:9606] [142365] (1 PDB entry) Uniprot P07203 12-195 |
Domain d2f8aa1: 2f8a A:12-195 [133119] Other proteins in same PDB: d2f8aa2 complexed with mla; mutant |
PDB Entry: 2f8a (more details), 1.5 Å
SCOPe Domain Sequences for d2f8aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} qsvyafsarplaggepvslgslrgkvllienvaslggttvrdytqmnelqrrlgprglvv lgfpcnqfghqenakneeilnslkyvrpgggfepnfmlfekcevngagahplfaflreal papsddatalmtdpklitwspvcrndvawnfekflvgpdgvplrrysrrfqtidiepdie alls
Timeline for d2f8aa1: