| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Populus trichocarpa [TaxId:3695] [187360] (4 PDB entries) |
| Domain d2p5ra_: 2p5r A: [167020] automated match to d2f8aa1 complexed with ca |
PDB Entry: 2p5r (more details), 2.45 Å
SCOPe Domain Sequences for d2p5ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5ra_ c.47.1.0 (A:) automated matches {Populus trichocarpa [TaxId: 3695]}
sknpesvhdftvkdakendvdlsifkgkvllivnvaskcgmtnsnyaemnqlyekykdqg
leilafpcnqfgeeepgtndqitdfvctrfksefpifdkidvngenasplyrflklgkwg
ifgddiqwnfakflvnkdgqvvdryypttsplslerdikqllei
Timeline for d2p5ra_: