Lineage for d2ooxe1 (2oox E:3-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550321Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2550433Protein Uncharacterized protein C1556.08c [160166] (1 species)
    consists of 4 CBS units
  7. 2550434Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160167] (2 PDB entries)
    Uniprot Q10343 182-334! Uniprot Q10343 3-181
  8. 2550435Domain d2ooxe1: 2oox E:3-181 [148944]
    Other proteins in same PDB: d2ooxa1, d2ooxb1, d2ooxc_, d2ooxd_, d2ooxe3, d2ooxg3
    complexed with amp

Details for d2ooxe1

PDB Entry: 2oox (more details), 2.6 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP
PDB Compounds: (E:) Hypothetical protein C1556.08c in chromosome I

SCOPe Domain Sequences for d2ooxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplwd
seankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiyv
hpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr

SCOPe Domain Coordinates for d2ooxe1:

Click to download the PDB-style file with coordinates for d2ooxe1.
(The format of our PDB-style files is described here.)

Timeline for d2ooxe1: