| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
| Protein Uncharacterized protein C1556.08c [160166] (1 species) consists of 4 CBS units |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160167] (2 PDB entries) Uniprot Q10343 182-334! Uniprot Q10343 3-181 |
| Domain d2ooxe1: 2oox E:3-181 [148944] Other proteins in same PDB: d2ooxa1, d2ooxb1, d2ooxc_, d2ooxd_, d2ooxe3, d2ooxg3 complexed with amp |
PDB Entry: 2oox (more details), 2.6 Å
SCOPe Domain Sequences for d2ooxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplwd
seankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiyv
hpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
Timeline for d2ooxe1: