SCOP 1.75: Domain d2ooxe1: 2oox E:3-181

Lineage for d2ooxe1 (2oox E:3-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (1 family)

5. Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Uncharacterized protein C1556.08c [160166] (1 species)
   consists of 4 CBS units

7. Species Schizosaccharomyces pombe [TaxId:4896] [160167] (1 PDB entry)
   Uniprot Q10343 182-334! Uniprot Q10343 3-181

8. Domain d2ooxe1: 2oox E:3-181 [148944]
   Other proteins in same PDB: d2ooxa1, d2ooxb1, d2ooxc1, d2ooxd1
   complexed with amp

Details for d2ooxe1

PDB Entry: 2oox, 2.6 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP

PDB Compounds: (E:) Hypothetical protein C1556.08c in chromosome I

SCOP Domain Sequences for d2ooxe1:

Sequence; same for both SEQRES and ATOM records:

>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]}
dvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplwd
seankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiyv
hpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr

Timeline for d2ooxe1:

• d2ooxe1 is new in SCOP 1.75
  
• d2ooxe1 appears in SCOPe 2.01
  
• d2ooxe1 appears in the current release, SCOPe 2.08