![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
![]() | Superfamily d.353.1: AMPKBI-like [160219] (1 family) ![]() automatically mapped to Pfam PF04739 |
![]() | Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
![]() | Protein AMP-activated protein kinase beta subunit [160225] (1 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160226] (2 PDB entries) Uniprot P78789 205-297 Spcc1919.03c |
![]() | Domain d2ooxb1: 2oox B:205-297 [148941] Other proteins in same PDB: d2ooxa1, d2ooxc_, d2ooxe1, d2ooxe2, d2ooxe3, d2ooxg1, d2ooxg2, d2ooxg3 complexed with amp |
PDB Entry: 2oox (more details), 2.6 Å
SCOPe Domain Sequences for d2ooxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooxb1 d.353.1.1 (B:205-297) AMP-activated protein kinase beta subunit {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh laaantqlgvlalsattryhrkyvttamfknfd
Timeline for d2ooxb1: