Lineage for d2onha2 (2onh A:272-599)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.128: Terpenoid synthases [48575] (1 superfamily)
multihelical; core: 8 helices (C-J) are arranged in 2 parallel layersSuperfamily a.128.1: Terpenoid synthases [48576] (6 families) 
duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-JFamily a.128.1.0: automated matches [196408] (1 protein)
not a true familyProtein automated matches [196409] (45 species)
not a true protein
Species Mentha spicata [TaxId:29719] [225229] (2 PDB entries) 
Domain d2onha2: 2onh A:272-599 [205338]
Other proteins in same PDB: d2onha1, d2onhb1
automated match to d1n1ba2
complexed with btb, f3p, mn
Details for d2onha2
PDB Entry: 2onh (more details), 2.7 Å
PDB Description: crystal structure of of limonene synthase with 2-fluorolinalyl diphosphate(flpp)
PDB Compounds: (A:) 4S-limonene synthaseSCOPe Domain Sequences for d2onha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onha2 a.128.1.0 (A:272-599) automated matches {Mentha spicata [TaxId: 29719]}
mnpvvlelaildlnivqaqfqeelkesfrwwrntgfveklpfardrlvecyfwntgiiep
rqhasarimmgkvnalitviddiydvygtleeleqftdlirrwdinsidqlpdymqlcfl
alnnfvddtsydvmkekgvnvipylrqswvdladkymvearwfygghkpsleeylenswq
sisgpcmlthiffrvtdsftketvdslykyhdlvrwssfvlrladdlgtsveevsrgdvp
kslqcymsdynaseaearkhvkwliaevwkkmnaervskdspfgkdfigcavdlgrmaql
myhngdghgtqhpiihqqmtrtlfepfa
SCOPe Domain Coordinates for d2onha2:
Click to download the PDB-style file with coordinates for d2onha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2onha2:
- d2onha2 first appeared in SCOPe 2.03
- d2onha2 appears in SCOPe 2.06
- d2onha2 appears in the current release, SCOPe 2.08
View in 3D
