Lineage for d2onhb2 (2onh B:272-599)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344939Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2344940Protein automated matches [196409] (45 species)
    not a true protein
  7. 2345015Species Mentha spicata [TaxId:29719] [225229] (2 PDB entries)
  8. 2345017Domain d2onhb2: 2onh B:272-599 [205340]
    Other proteins in same PDB: d2onha1, d2onhb1
    automated match to d1n1ba2
    complexed with btb, f3p, mn

Details for d2onhb2

PDB Entry: 2onh (more details), 2.7 Å

PDB Description: crystal structure of of limonene synthase with 2-fluorolinalyl diphosphate(flpp)
PDB Compounds: (B:) 4S-limonene synthase

SCOPe Domain Sequences for d2onhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onhb2 a.128.1.0 (B:272-599) automated matches {Mentha spicata [TaxId: 29719]}
mnpvvlelaildlnivqaqfqeelkesfrwwrntgfveklpfardrlvecyfwntgiiep
rqhasarimmgkvnalitviddiydvygtleeleqftdlirrwdinsidqlpdymqlcfl
alnnfvddtsydvmkekgvnvipylrqswvdladkymvearwfygghkpsleeylenswq
sisgpcmlthiffrvtdsftketvdslykyhdlvrwssfvlrladdlgtsveevsrgdvp
kslqcymsdynaseaearkhvkwliaevwkkmnaervskdspfgkdfigcavdlgrmaql
myhngdghgtqhpiihqqmtrtlfepfa

SCOPe Domain Coordinates for d2onhb2:

Click to download the PDB-style file with coordinates for d2onhb2.
(The format of our PDB-style files is described here.)

Timeline for d2onhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onhb1