![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Mentha spicata [TaxId:29719] [225229] (2 PDB entries) |
![]() | Domain d2onha2: 2onh A:272-599 [205338] Other proteins in same PDB: d2onha1, d2onhb1 automated match to d1n1ba2 complexed with btb, f3p, mn |
PDB Entry: 2onh (more details), 2.7 Å
SCOPe Domain Sequences for d2onha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onha2 a.128.1.0 (A:272-599) automated matches {Mentha spicata [TaxId: 29719]} mnpvvlelaildlnivqaqfqeelkesfrwwrntgfveklpfardrlvecyfwntgiiep rqhasarimmgkvnalitviddiydvygtleeleqftdlirrwdinsidqlpdymqlcfl alnnfvddtsydvmkekgvnvipylrqswvdladkymvearwfygghkpsleeylenswq sisgpcmlthiffrvtdsftketvdslykyhdlvrwssfvlrladdlgtsveevsrgdvp kslqcymsdynaseaearkhvkwliaevwkkmnaervskdspfgkdfigcavdlgrmaql myhngdghgtqhpiihqqmtrtlfepfa
Timeline for d2onha2: