Lineage for d2jmua1 (2jmu A:2-224)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through itSuperfamily d.63.1: CYTH-like phosphatases [55154] (3 families) 
Family d.63.1.2: CYTH domain [118007] (5 proteins)
Pfam PF01928Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [160429] (2 PDB entries)
Uniprot Q8JZL3 2-224
Domain d2jmua1: 2jmu A:2-224 [148140]
Other proteins in same PDB: d2jmua2
Details for d2jmua1
PDB Entry: 2jmu (more details)
PDB Description: nmr structure of the mouse thiamine triphosphatase
PDB Compounds: (A:) Thiamine-triphosphataseSCOPe Domain Sequences for d2jmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
aqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsg
welkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasf
ittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssm
lgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsas
SCOPe Domain Coordinates for d2jmua1:
Click to download the PDB-style file with coordinates for d2jmua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jmua1:
- d2jmua1 first appeared in SCOP 1.75
- d2jmua1 appears in SCOPe 2.06
- d2jmua1 appears in the current release, SCOPe 2.08
View in 3D
