SCOP 1.75: Domain d2jmua1: 2jmu A:2-224

Lineage for d2jmua1 (2jmu A:2-224)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families)

5. Family d.63.1.2: CYTH domain [118007] (4 proteins)
   Pfam PF01928

6. Protein Thiamine-triphosphatase (ThTPase) [160428] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [160429] (1 PDB entry)
   Uniprot Q8JZL3 2-224

8. Domain d2jmua1: 2jmu A:2-224 [148140]

Details for d2jmua1

PDB Entry: 2jmu

PDB Description: nmr structure of the mouse thiamine triphosphatase

PDB Compounds: (A:) Thiamine-triphosphatase

SCOP Domain Sequences for d2jmua1:

Sequence; same for both SEQRES and ATOM records:

>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
aqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsg
welkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasf
ittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssm
lgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsas

Timeline for d2jmua1:

• d2jmua1 is new in SCOP 1.75
  
• d2jmua1 appears in SCOPe 2.01
  
• d2jmua1 appears in the current release, SCOPe 2.08