PDB entry 2jmu

View 2jmu on RCSB PDB site
Description: NMR structure of the mouse thiamine triphosphatase
Class: hydrolase
Keywords: thiamine triphosphatase, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE
Deposited on 2006-12-05, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thiamine-triphosphatase
  Species: Mus musculus [TaxId:10090]
  Gene: Thtpa
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8JZL3 (1-223)
    • cloning artifact (0)
  Domains in SCOPe 2.07: d2jmua1, d2jmua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jmuA (A:)
  saqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregs
  gwelkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevas
  fittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvss
  mlgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsas