Class a: All alpha proteins [46456] (286 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.0: automated matches [191469] (1 protein) not a true family |
Protein automated matches [190736] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187912] (2 PDB entries) |
Domain d2jg6a_: 2jg6 A: [166173] automated match to d1lmza_ complexed with zn |
PDB Entry: 2jg6 (more details), 1.7 Å
SCOPe Domain Sequences for d2jg6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg6a_ a.96.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} mnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp skpkhn
Timeline for d2jg6a_: