Lineage for d2jg6a_ (2jg6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721131Family a.96.1.0: automated matches [191469] (1 protein)
    not a true family
  6. 2721132Protein automated matches [190736] (2 species)
    not a true protein
  7. 2721133Species Staphylococcus aureus [TaxId:1280] [187912] (2 PDB entries)
  8. 2721139Domain d2jg6a_: 2jg6 A: [166173]
    automated match to d1lmza_
    complexed with zn

Details for d2jg6a_

PDB Entry: 2jg6 (more details), 1.7 Å

PDB Description: crystal structure of a 3-methyladenine dna glycosylase i from staphylococcus aureus
PDB Compounds: (A:) DNA-3-methyladenine glycosidase

SCOPe Domain Sequences for d2jg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg6a_ a.96.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

SCOPe Domain Coordinates for d2jg6a_:

Click to download the PDB-style file with coordinates for d2jg6a_.
(The format of our PDB-style files is described here.)

Timeline for d2jg6a_: