PDB entry 2jg6

View 2jg6 on RCSB PDB site
Description: crystal structure of a 3-methyladenine DNA glycosylase I from staphylococcus aureus
Class: hydrolase
Keywords: glycosidase, 3-methyladenine-DNA-glycosylase-I, hydrolase
Deposited on 2007-02-08, released 2007-02-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosidase
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RL93 (0-185)
      • conflict (14)
      • conflict (176)
    Domains in SCOPe 2.05: d2jg6a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jg6A (A:)
    mnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
    ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
    ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
    skpkhn