Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
Protein Hypothetical protein TTC0031 [159498] (1 species) TT0030 |
Species Thermus thermophilus [TaxId:274] [159499] (1 PDB entry) Uniprot Q72LM7 2-135 |
Domain d2iela1: 2iel A:2-135 [147649] |
PDB Entry: 2iel (more details), 1.6 Å
SCOPe Domain Sequences for d2iela1:
Sequence, based on SEQRES records: (download)
>d2iela1 c.26.2.4 (A:2-135) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]} arylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeeaa aakraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvht qaerfglpvihvia
>d2iela1 c.26.2.4 (A:2-135) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]} arylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvynevrrraeeeaaaa kraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtqa erfglpvihvia
Timeline for d2iela1: