Lineage for d2iela1 (2iel A:2-135)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) 
share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
Pfam PF00582
Protein Hypothetical protein TTC0031 [159498] (1 species)
TT0030Species Thermus thermophilus [TaxId:274] [159499] (1 PDB entry)
Uniprot Q72LM7 2-135
Domain d2iela1: 2iel A:2-135 [147649]
Details for d2iela1
PDB Entry: 2iel (more details), 1.6 Å
PDB Description: crystal structure of tt0030 from thermus thermophilus
PDB Compounds: (A:) Hypothetical Protein TT0030SCOPe Domain Sequences for d2iela1:
Sequence, based on SEQRES records: (download)
>d2iela1 c.26.2.4 (A:2-135) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
arylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeeaa
aakraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvht
qaerfglpvihvia
Sequence, based on observed residues (ATOM records): (download)
>d2iela1 c.26.2.4 (A:2-135) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
arylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvynevrrraeeeaaaa
kraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtqa
erfglpvihvia
SCOPe Domain Coordinates for d2iela1:
Click to download the PDB-style file with coordinates for d2iela1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2iela1:
- d2iela1 first appeared in SCOP 1.75
- d2iela1 appears in SCOPe 2.05
- d2iela1 appears in SCOPe 2.07
- d2iela1 appears in the current release, SCOPe 2.08
View in 3D
