Lineage for d2iela1 (2iel A:2-135)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469731Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2469748Protein Hypothetical protein TTC0031 [159498] (1 species)
    TT0030
  7. 2469749Species Thermus thermophilus [TaxId:274] [159499] (1 PDB entry)
    Uniprot Q72LM7 2-135
  8. 2469750Domain d2iela1: 2iel A:2-135 [147649]

Details for d2iela1

PDB Entry: 2iel (more details), 1.6 Å

PDB Description: crystal structure of tt0030 from thermus thermophilus
PDB Compounds: (A:) Hypothetical Protein TT0030

SCOPe Domain Sequences for d2iela1:

Sequence, based on SEQRES records: (download)

>d2iela1 c.26.2.4 (A:2-135) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
arylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeeaa
aakraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvht
qaerfglpvihvia

Sequence, based on observed residues (ATOM records): (download)

>d2iela1 c.26.2.4 (A:2-135) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
arylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvynevrrraeeeaaaa
kraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtqa
erfglpvihvia

SCOPe Domain Coordinates for d2iela1:

Click to download the PDB-style file with coordinates for d2iela1.
(The format of our PDB-style files is described here.)

Timeline for d2iela1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ielb_