SCOPe 2.06: Domain d2ielb_: 2iel B:

Lineage for d2ielb_ (2iel B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein Hypothetical protein TTC0031 [159498] (1 species)
   TT0030

7. Species Thermus thermophilus [TaxId:274] [159499] (1 PDB entry)
   Uniprot Q72LM7 2-135

8. Domain d2ielb_: 2iel B: [147650]
   automated match to d2iela1

Details for d2ielb_

PDB Entry: 2iel, 1.6 Å

PDB Description: crystal structure of tt0030 from thermus thermophilus

PDB Compounds: (B:) Hypothetical Protein TT0030

SCOPe Domain Sequences for d2ielb_:

Sequence, based on SEQRES records:

>d2ielb_ c.26.2.4 (B:) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
rylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeeaaa
akraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtq
aerfglpvihviaq

Sequence, based on observed residues (ATOM records):

>d2ielb_ c.26.2.4 (B:) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
rylvvahrtakspelaaklkelarfvllvpavpppgwvyenevrrraeeeaaaakralea
qgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtqaerfglp
vihviaq

Timeline for d2ielb_:

• d2ielb_ first appeared in SCOP 1.75, called d2ielb1
  
• d2ielb_ appears in SCOPe 2.05
  
• d2ielb_ appears in SCOPe 2.07
  
• d2ielb_ appears in the current release, SCOPe 2.08