![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) ![]() |
![]() | Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
![]() | Protein Hypothetical protein SP2199 [143407] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143408] (1 PDB entry) Uniprot Q97N67 1-90 |
![]() | Domain d2iboa1: 2ibo A:1-90 [137197] |
PDB Entry: 2ibo (more details), 2.8 Å
SCOPe Domain Sequences for d2iboa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iboa1 d.58.48.1 (A:1-90) Hypothetical protein SP2199 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal evagqeadnvfanvkinvgeilsideklek
Timeline for d2iboa1: