PDB entry 2ibo

View 2ibo on RCSB PDB site
Description: X-ray Crystal Structure of Protein SP2199 from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR31
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-09-11, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SP2199
    Species: Streptococcus pneumoniae TIGR4 [TaxId:170187]
    Gene: SP_2199
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97N67 (0-End)
      • modified residue (0)
      • modified residue (35)
      • modified residue (52)
    Domains in SCOPe 2.08: d2iboa1
  • Chain 'B':
    Compound: Hypothetical protein SP2199
    Species: Streptococcus pneumoniae TIGR4 [TaxId:170187]
    Gene: SP_2199
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97N67 (0-End)
      • modified residue (0)
      • modified residue (35)
      • modified residue (52)
    Domains in SCOPe 2.08: d2ibob_
  • Chain 'C':
    Compound: Hypothetical protein SP2199
    Species: Streptococcus pneumoniae TIGR4 [TaxId:170187]
    Gene: SP_2199
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97N67 (0-End)
      • modified residue (0)
      • modified residue (35)
      • modified residue (52)
    Domains in SCOPe 2.08: d2iboc_
  • Chain 'D':
    Compound: Hypothetical protein SP2199
    Species: Streptococcus pneumoniae TIGR4 [TaxId:170187]
    Gene: SP_2199
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97N67 (0-End)
      • modified residue (0)
      • modified residue (35)
      • modified residue (52)
    Domains in SCOPe 2.08: d2ibod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iboA (A:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklekytetthlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iboA (A:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iboB (B:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklekytetthlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iboB (B:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iboC (C:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklekytetthlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iboC (C:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iboD (D:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklekytetthlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iboD (D:)
    mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
    evagqeadnvfanvkinvgeilsideklek