Lineage for d2ibob_ (2ibo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955711Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 2955712Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 2955722Protein Hypothetical protein SP2199 [143407] (1 species)
  7. 2955723Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143408] (1 PDB entry)
    Uniprot Q97N67 1-90
  8. 2955725Domain d2ibob_: 2ibo B: [137198]
    automated match to d2iboa1

Details for d2ibob_

PDB Entry: 2ibo (more details), 2.8 Å

PDB Description: X-ray Crystal Structure of Protein SP2199 from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR31
PDB Compounds: (B:) Hypothetical protein SP2199

SCOPe Domain Sequences for d2ibob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibob_ d.58.48.1 (B:) Hypothetical protein SP2199 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
evagqeadnvfanvkinvgeilsideklek

SCOPe Domain Coordinates for d2ibob_:

Click to download the PDB-style file with coordinates for d2ibob_.
(The format of our PDB-style files is described here.)

Timeline for d2ibob_: