Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) |
Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
Protein Hypothetical protein SP2199 [143407] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143408] (1 PDB entry) Uniprot Q97N67 1-90 |
Domain d2ibod_: 2ibo D: [137200] automated match to d2iboa1 |
PDB Entry: 2ibo (more details), 2.8 Å
SCOPe Domain Sequences for d2ibod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibod_ d.58.48.1 (D:) Hypothetical protein SP2199 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal evagqeadnvfanvkinvgeilsideklek
Timeline for d2ibod_: