Lineage for d2i53a2 (2i53 A:158-267)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003766Protein Cyclin K [158591] (1 species)
  7. 2003767Species Human (Homo sapiens) [TaxId:9606] [158592] (1 PDB entry)
    Uniprot O75909 14-157! Uniprot O75909 158-267
  8. 2003769Domain d2i53a2: 2i53 A:158-267 [147506]
    complexed with act

Details for d2i53a2

PDB Entry: 2i53 (more details), 1.5 Å

PDB Description: Crystal structure of Cyclin K
PDB Compounds: (A:) Cyclin K

SCOPe Domain Sequences for d2i53a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqmph

SCOPe Domain Coordinates for d2i53a2:

Click to download the PDB-style file with coordinates for d2i53a2.
(The format of our PDB-style files is described here.)

Timeline for d2i53a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i53a1