| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin K [158591] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158592] (1 PDB entry) Uniprot O75909 14-157! Uniprot O75909 158-267 |
| Domain d2i53a2: 2i53 A:158-267 [147506] complexed with act |
PDB Entry: 2i53 (more details), 1.5 Å
SCOPe Domain Sequences for d2i53a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqmph
Timeline for d2i53a2: