Lineage for d2hyma1 (2hym A:1-109)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Interferon-alpha/beta receptor beta chain [89199] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89200] (5 PDB entries) 
Domain d2hyma1: 2hym A:1-109 [136898]
Other proteins in same PDB: d2hymb_
automated match to d2hyma1
Details for d2hyma1
PDB Entry: 2hym (more details)
PDB Description: nmr based docking model of the complex between the human type i interferon receptor and human interferon alpha-2
PDB Compounds: (A:) Soluble IFN alpha/beta receptorSCOPe Domain Sequences for d2hyma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep
SCOPe Domain Coordinates for d2hyma1:
Click to download the PDB-style file with coordinates for d2hyma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hyma1:
- d2hyma1 first appeared in SCOP 1.73
- d2hyma1 appears in SCOPe 2.06
- d2hyma1 appears in the current release, SCOPe 2.08
View in 3D
