Lineage for d2hyma1 (2hym A:1-109)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 protein domains)
    Pfam PF00041
  6. 657454Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)
  7. 657455Species Human (Homo sapiens) [TaxId:9606] [89200] (3 PDB entries)
  8. 657456Domain d2hyma1: 2hym A:1-109 [136898]
    Other proteins in same PDB: d2hymb1
    automatically matched to d1n6ua1

Details for d2hyma1

PDB Entry: 2hym (more details)

PDB Description: NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and Human Interferon alpha-2
PDB Compounds: (A:) Soluble IFN alpha/beta receptor

SCOP Domain Sequences for d2hyma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep

SCOP Domain Coordinates for d2hyma1:

Click to download the PDB-style file with coordinates for d2hyma1.
(The format of our PDB-style files is described here.)

Timeline for d2hyma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hyma2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hymb1