Lineage for d2hv8d1 (2hv8 D:703-756)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040629Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 3040630Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 3040636Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)
  7. 3040637Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
    Uniprot O75154 703-756! Uniprot O75154 715-756
  8. 3040640Domain d2hv8d1: 2hv8 D:703-756 [136797]
    Other proteins in same PDB: d2hv8a_, d2hv8b_, d2hv8c_
    complexed with 2me, gtp, mes, mg, so4

Details for d2hv8d1

PDB Entry: 2hv8 (more details), 1.86 Å

PDB Description: crystal structure of gtp-bound rab11 in complex with fip3
PDB Compounds: (D:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d2hv8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv8d1 h.1.31.1 (D:703-756) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
afseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

SCOPe Domain Coordinates for d2hv8d1:

Click to download the PDB-style file with coordinates for d2hv8d1.
(The format of our PDB-style files is described here.)

Timeline for d2hv8d1: