Lineage for d2hfia1 (2hfi A:1-123)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1727515Superfamily a.24.26: YppE-like [140415] (1 family) (S)
    flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3
    automatically mapped to Pfam PF08807
  5. 1727516Family a.24.26.1: YppE-like [140416] (3 proteins)
    Pfam PF08807; DUF1798
  6. 1727523Protein Hypothetical protein YppE [140421] (1 species)
  7. 1727524Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries)
    Uniprot P50833 1-123
  8. 1727527Domain d2hfia1: 2hfi A:1-123 [136385]

Details for d2hfia1

PDB Entry: 2hfi (more details)

PDB Description: solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213
PDB Compounds: (A:) Hypothetical protein yppE

SCOPe Domain Sequences for d2hfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfia1 a.24.26.1 (A:1-123) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
dsr

SCOPe Domain Coordinates for d2hfia1:

Click to download the PDB-style file with coordinates for d2hfia1.
(The format of our PDB-style files is described here.)

Timeline for d2hfia1: