Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.26: YppE-like [140415] (1 family) flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3 automatically mapped to Pfam PF08807 |
Family a.24.26.1: YppE-like [140416] (3 proteins) Pfam PF08807; DUF1798 |
Protein Hypothetical protein YppE [140421] (1 species) |
Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries) Uniprot P50833 1-123 |
Domain d2hfia1: 2hfi A:1-123 [136385] |
PDB Entry: 2hfi (more details)
SCOPe Domain Sequences for d2hfia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hfia1 a.24.26.1 (A:1-123) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]} mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare dsr
Timeline for d2hfia1: