SCOPe 2.04: Domain d2hfia1: 2hfi A:1-123

Lineage for d2hfia1 (2hfi A:1-123)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.26: YppE-like [140415] (1 family)
   flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3
   automatically mapped to Pfam PF08807

5. Family a.24.26.1: YppE-like [140416] (3 proteins)
   Pfam PF08807; DUF1798

6. Protein Hypothetical protein YppE [140421] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries)
   Uniprot P50833 1-123

8. Domain d2hfia1: 2hfi A:1-123 [136385]

Details for d2hfia1

PDB Entry: 2hfi

PDB Description: solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213

PDB Compounds: (A:) Hypothetical protein yppE

SCOPe Domain Sequences for d2hfia1:

Sequence; same for both SEQRES and ATOM records:

>d2hfia1 a.24.26.1 (A:1-123) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
dsr

Timeline for d2hfia1:

• d2hfia1 first appeared in SCOP 1.73
  
• d2hfia1 appears in SCOPe 2.03
  
• d2hfia1 appears in SCOPe 2.05
  
• d2hfia1 appears in the current release, SCOPe 2.08