Lineage for d2hbja1 (2hbj A:421-516)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716244Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2716282Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins)
  6. 2716283Protein Exosome complex exonuclease RRP6 domain [140647] (1 species)
  7. 2716284Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries)
    Uniprot Q12149 421-516
  8. 2716285Domain d2hbja1: 2hbj A:421-516 [136311]
    Other proteins in same PDB: d2hbja2, d2hbja3

Details for d2hbja1

PDB Entry: 2hbj (more details), 2.1 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain
PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOPe Domain Sequences for d2hbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbja1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv
igvvsltngvtehvrqnakllanlirdalrnikntn

SCOPe Domain Coordinates for d2hbja1:

Click to download the PDB-style file with coordinates for d2hbja1.
(The format of our PDB-style files is described here.)

Timeline for d2hbja1: