SCOP 1.73: Domain d2hbja1: 2hbj A:421-516

Lineage for d2hbja1 (2hbj A:421-516)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.8: HRDC-like [47819] (4 families)

5. Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins)

6. Protein Exosome complex exonuclease RRP6 domain [140647] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries)

8. Domain d2hbja1: 2hbj A:421-516 [136311]
   Other proteins in same PDB: d2hbja2
   mutant

Details for d2hbja1

PDB Entry: 2hbj, 2.1 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain

PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOP Domain Sequences for d2hbja1:

Sequence; same for both SEQRES and ATOM records:

>d2hbja1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv
igvvsltngvtehvrqnakllanlirdalrnikntn

Timeline for d2hbja1:

• d2hbja1 is new in SCOP 1.73
  
• d2hbja1 appears in SCOP 1.75
  
• d2hbja1 appears in the current release, SCOPe 2.08