| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) ![]() |
| Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins) |
| Protein Exosome complex exonuclease RRP6 domain [140647] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries) |
| Domain d2hbja1: 2hbj A:421-516 [136311] Other proteins in same PDB: d2hbja2 mutant |
PDB Entry: 2hbj (more details), 2.1 Å
SCOP Domain Sequences for d2hbja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbja1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv
igvvsltngvtehvrqnakllanlirdalrnikntn
Timeline for d2hbja1: