Lineage for d2gyqa1 (2gyq A:1-160)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703802Family a.25.1.4: YciF-like [140445] (3 proteins)
    Pfam PF05974; DUF892
  6. 2703807Protein Hypothetical ptotein RPA3308 [140446] (1 species)
    putative structural protein
  7. 2703808Species Rhodopseudomonas palustris [TaxId:1076] [140447] (1 PDB entry)
    Uniprot Q6N4M9 1-160
  8. 2703809Domain d2gyqa1: 2gyq A:1-160 [135863]
    complexed with act, edo, fe, na, zn

Details for d2gyqa1

PDB Entry: 2gyq (more details), 1.4 Å

PDB Description: YcfI, a putative structural protein from Rhodopseudomonas palustris.
PDB Compounds: (A:) ycfI, putative structural protein

SCOPe Domain Sequences for d2gyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyqa1 a.25.1.4 (A:1-160) Hypothetical ptotein RPA3308 {Rhodopseudomonas palustris [TaxId: 1076]}
mgffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqi
erldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiar
ygtliawaeelghddivrflttnlneekaantklntvalr

SCOPe Domain Coordinates for d2gyqa1:

Click to download the PDB-style file with coordinates for d2gyqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gyqa1:

2703809
d2gyqa1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2gyqb_