| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.4: YciF-like [140445] (3 proteins) Pfam PF05974; DUF892 |
| Protein Hypothetical ptotein RPA3308 [140446] (1 species) putative structural protein |
| Species Rhodopseudomonas palustris [TaxId:1076] [140447] (1 PDB entry) Uniprot Q6N4M9 1-160 |
| Domain d2gyqb_: 2gyq B: [135864] automated match to d2gyqa1 complexed with act, edo, fe, na, zn |
PDB Entry: 2gyq (more details), 1.4 Å
SCOPe Domain Sequences for d2gyqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyqb_ a.25.1.4 (B:) Hypothetical ptotein RPA3308 {Rhodopseudomonas palustris [TaxId: 1076]}
ffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqier
ldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiaryg
tliawaeelghddivrflttnlneekaantklntval
Timeline for d2gyqb_: