PDB entry 2gyq

View 2gyq on RCSB PDB site
Description: YcfI, a putative structural protein from Rhodopseudomonas palustris.
Class: structural genomics, unknown function
Keywords: structural genomics, APC6105, iron-binding, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-05-09, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.14
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ycfI, putative structural protein
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA3308
    Database cross-references and differences (RAF-indexed):
    • GB CAE28749 (2-End)
    Domains in SCOPe 2.08: d2gyqa1
  • Chain 'B':
    Compound: ycfI, putative structural protein
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA3308
    Database cross-references and differences (RAF-indexed):
    • GB CAE28749
    Domains in SCOPe 2.08: d2gyqb_
  • Heterogens: FE, ZN, NA, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gyqA (A:)
    ghmgffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqk
    qierldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyei
    arygtliawaeelghddivrflttnlneekaantklntvalrkgvnrkaasgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyqA (A:)
    mgffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqi
    erldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiar
    ygtliawaeelghddivrflttnlneekaantklntvalras
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gyqB (B:)
    ghmgffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqk
    qierldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyei
    arygtliawaeelghddivrflttnlneekaantklntvalrkgvnrkaasgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyqB (B:)
    ffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqier
    ldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiaryg
    tliawaeelghddivrflttnlneekaantklntval